PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_14244
Common NameKK1_014672
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 924aa    MW: 101471 Da    PI: 5.7343
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_14244genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-183783148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd++l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
    C.cajan_14244 37 KGQWTPEEDDILRKAVQRFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 83
                     799****************************9.************986 PP

2Myb_DNA-binding62.77.6e-2089135148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde+++++vkq G++ W++Ia++++ gR +kqc++rw ++l
    C.cajan_14244  89 KGPWSKEEDEIIIELVKQNGPKKWSAIAQHLP-GRIGKQCRERWCNHL 135
                      79******************************.************996 PP

3Myb_DNA-binding47.93.2e-15141183145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++ ++++G++ W+  ++ ++ gRt++ +k++w+
    C.cajan_14244 141 KEAWTQEEELALIHFHRMYGNK-WAELSKFIP-GRTDNAIKNHWN 183
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.9993283IPR017930Myb domain
SMARTSM007171.8E-153685IPR001005SANT/Myb domain
PfamPF002492.5E-163783IPR001005SANT/Myb domain
SuperFamilySSF466898.61E-163893IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-223895IPR009057Homeodomain-like
CDDcd001674.74E-144083No hitNo description
PROSITE profilePS5129432.184139IPR017930Myb domain
SuperFamilySSF466891.72E-3086182IPR009057Homeodomain-like
SMARTSM007171.5E-1888137IPR001005SANT/Myb domain
PfamPF002491.5E-1889135IPR001005SANT/Myb domain
CDDcd001671.96E-1691135No hitNo description
Gene3DG3DSA:1.10.10.606.4E-2796142IPR009057Homeodomain-like
SMARTSM007174.1E-15140188IPR001005SANT/Myb domain
PROSITE profilePS5129420.532140190IPR017930Myb domain
PfamPF002496.3E-14141184IPR001005SANT/Myb domain
CDDcd001671.16E-11143183No hitNo description
Gene3DG3DSA:1.10.10.602.6E-21143190IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 924 aa     Download sequence    Send to blast
MDSEQSMPAP SHEYADGSQK VRALHGRTTG PTRRSTKGQW TPEEDDILRK AVQRFKGKNW  60
KKIAECFKDR TDVQCLHRWQ KVLNPELVKG PWSKEEDEII IELVKQNGPK KWSAIAQHLP  120
GRIGKQCRER WCNHLDPTIK KEAWTQEEEL ALIHFHRMYG NKWAELSKFI PGRTDNAIKN  180
HWNSSVKKKL DSYLASGLLS QIESVPHVGN SNQPTRLQCS DDNGPKGTEV EEVSQCSQGS  240
ANAACFPSAR GTSSVSASGP ASMDSLKPEH MLISDEECCR VLFSDATDDG CFSHVDYNKG  300
EDMVGFSGCT SFLCQSCNIQ ISEMGGTSTP HPTCPQCSNN YRGASSSQSV PMVLSDSDDR  360
LVTTANGNQF FGTEDYQFVS RAPANSTYFS ELSGSPCADG IGSEVMKEPH DILKGTSELV  420
PVNTSGCVSN AKQICNPTDE KTNVHTEKED PGSLCYEPPR FPSLDIPFFS CDLVQSGSDL  480
QQEFSPLGLR QFMIPSMNCL TPFRLWDSPS RDDSPDALLK SAAKTFTGTP SILKKRHRDL  540
LSPLSDKRID KKLGTDMAST FTKNLPSLDV MFGDNETQEV DMPSSSSSLQ KQNSSAPVDD  600
DNKENCGQAY KGEQVEHQSA ILDEKSSQKD TVNSNSQHNV KQHSLDSKMK VDATSTEIEQ  660
QPSGVLVEHD VNDLSLSSPD QVGLKSDRGS GSSAKTPKSL NRSMEAAPNQ SGHLKLSSEN  720
PCSRVKSNSS CVRAKEHEKL SVAVTRVQAL GDNSGEQTRM DGGFETCSIF GGTPFRKGIE  780
SPSAWKSPWF FNPFLSSPRL DTDITIEDFQ YLMRSPGDRS YDAIGLLKQI SEQTAATYAN  840
AQEILVNETP KALPKDPSGN DEARDQENNP PSQPGNHSQL ASNALIERRT LDFSECGTPG  900
KGDNNKSSSV SFSSPSSYLL KGCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-65371906159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-65371906159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-145AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007137183.10.0hypothetical protein PHAVU_009G106700g
SwissprotQ9S7G71e-102MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A151SWR90.0A0A151SWR9_CAJCA; Myb-related protein 3R-1
STRINGGLYMA17G26240.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37273362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-103Homeodomain-like protein